PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr041889.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 280aa    MW: 31375.6 Da    PI: 4.715
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr041889.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding25.72.6e-088381748
                     HHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding 17 kqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +lG   W+++++  g++R++k+c++rw +yl
      Pbr041889.1  8 DKLGCC-WRAVPKLAGLRRCGKSCRLRWTNYL 38
                     589988.***********************97 PP

2Myb_DNA-binding52.31.3e-164788447
                     S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                      T+ E++l +d++++lG++ W++Ia +++ gRt++++k++w+++
      Pbr041889.1 47 LTEAEEQLVIDLHARLGNR-WSKIAGRLP-GRTDNEIKNHWNTH 88
                     699****************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.04138IPR017877Myb-like domain
SMARTSM0071720240IPR001005SANT/Myb domain
PfamPF002491.3E-6738IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.2E-11844IPR009057Homeodomain-like
SuperFamilySSF466894.6E-212497IPR009057Homeodomain-like
PROSITE profilePS5129427.2953993IPR017930Myb domain
SMARTSM007171.2E-144391IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-244593IPR009057Homeodomain-like
PfamPF002491.2E-144688IPR001005SANT/Myb domain
CDDcd001673.80E-114889No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 280 aa     Download sequence    Send to blast
MGRQPCCDKL GCCWRAVPKL AGLRRCGKSC RLRWTNYLRP DLKRGLLTEA EEQLVIDLHA  60
RLGNRWSKIA GRLPGRTDNE IKNHWNTHIK KKLLRMGIDP VTHEPLHKEE ELASNIKETN  120
SSSSSSHDHD DHNNNLPADQ STNDLHNSQE NDQSVVNSSG SEEINSSTEN SSTGAESVLL  180
NNICNDDSLM NSLWMDETPL IDALWNDNNQ VELDQGGIDY NIIENNGMGF QSNWEDNCAW  240
LLDCQDFGIH DFGMDCFNDV EVNGNKTLEV GGKLSTKIN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-20259340108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009362121.10.0PREDICTED: LOW QUALITY PROTEIN: protein ODORANT1
SwissprotQ50EX63e-86ODO1_PETHY; Protein ODORANT1
TrEMBLM5WYP61e-133M5WYP6_PRUPE; Uncharacterized protein
STRINGGLYMA01G42050.11e-107(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF65334142
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G22680.11e-74myb domain protein 85